Protein Info for HP15_840 in Marinobacter adhaerens HP15

Annotation: ABC transporter, transmembrane region: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 transmembrane" amino acids 77 to 98 (22 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details amino acids 294 to 321 (28 residues), see Phobius details PF00664: ABC_membrane" amino acids 29 to 310 (282 residues), 159.4 bits, see alignment E=1.6e-50 PF00005: ABC_tran" amino acids 374 to 522 (149 residues), 123.5 bits, see alignment E=9.7e-40

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 90% identity to maq:Maqu_2187)

Predicted SEED Role

"ABC transporter, multidrug efflux family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PR69 at UniProt or InterPro

Protein Sequence (600 amino acids)

>HP15_840 ABC transporter, transmembrane region: ABC transporter (Marinobacter adhaerens HP15)
MSSHSHQTTSSFAALARLLRYARGYRRQIIAATTCSIINKLFDIAPEILIGVAIDVVVNQ
EESFVAGLGFETAQEQITILAVLTFFIWAGESLFEYLFQILWRNLAQRLQSDLRQDAYEH
AQRLDMSFFEARSSGQLVATMNDDVNQLERFLDGGANAMIQVLVTVVAVGAVFFVLSPLI
ALLAFTPIPLIIWGAFYFQRKAGPLYADVREKVGDLSSRLANNLGGIATIKSFTAEQREA
KRLKESSEAYVEANRRAIRISSAFIPVIRMAILAGFLATFTVGGMMALEGNLNVGAYGVL
VFLTQRLLWPLTGLAEVIDLFERAMASTRRILDLLAEPVHVRDEGGKALAEPVKGDVELD
KVSFHYPSSGAGIQDISLTVPAGNTLALVGATGSGKSTLIKLLLRFYDPSNGQIRIDGQP
IRDLNLQSLRGAIGLVSQDVYLFEGTIRENLAYGNPAASDTEIIDAAKTAEAWSFIEALP
EGLNTPVGERGVRLSGGQRQRLSLARALLKNPPILVLDEATSAVDNETEAAIQRSLKRIG
HNRTVIMIAHRLSTIVDADSIAVIEGGKVLEQGTHRELLDQDGAYANQWRVQTGQIQAAI