Protein Info for HP15_839 in Marinobacter adhaerens HP15

Annotation: iron-hydroxamate transporter ATP-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00005: ABC_tran" amino acids 20 to 168 (149 residues), 115.3 bits, see alignment E=3.3e-37

Best Hits

Swiss-Prot: 55% identical to FHUC_ECOLI: Iron(3+)-hydroxamate import ATP-binding protein FhuC (fhuC) from Escherichia coli (strain K12)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 80% identity to maq:Maqu_2188)

MetaCyc: 55% identical to iron(III) hydroxamate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-11-RXN [EC: 7.2.2.16]; TRANS-RXN-297 [EC: 7.2.2.16]; TRANS-RXN-298 [EC: 7.2.2.16]

Predicted SEED Role

"Ferric hydroxamate ABC transporter (TC 3.A.1.14.3), ATP-binding protein FhuC" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin (TC 3.A.1.14.3)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PR68 at UniProt or InterPro

Protein Sequence (257 amino acids)

>HP15_839 iron-hydroxamate transporter ATP-binding subunit (Marinobacter adhaerens HP15)
MPVFFDVSNLDVRIGDTTILQNLNLGFGEGEVTALLGHNGSGKSTLLKVLARQLAPSTGN
VRLLGKSFRSTGAREFARNVGYLPQHPPGTDGLTVRELVALGRYPWRGPLGRYNEEDHRL
ITRAIEDTGLGQFQHRSVDTLSGGERQRAWIAMLLAQQTRCLLLDEPISALDVKHQVETL
RLVHRLAEQRDLTVIVVLHDVDLAARFCDRLVALKSGQLVADGSPRDIMDSGILESIYGV
PMGVMERAPGQWVSYVH