Protein Info for Psest_0873 in Pseudomonas stutzeri RCH2

Annotation: HipA N-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 TIGR03071: HipA N-terminal domain" amino acids 4 to 106 (103 residues), 63.4 bits, see alignment E=8.7e-22 PF13657: Couple_hipA" amino acids 5 to 106 (102 residues), 66.5 bits, see alignment E=2.6e-22 PF07804: HipA_C" amino acids 146 to 334 (189 residues), 172.1 bits, see alignment E=1.4e-54

Best Hits

KEGG orthology group: K07154, (no description) (inferred from 57% identity to avn:Avin_30640)

Predicted SEED Role

"HipA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHL6 at UniProt or InterPro

Protein Sequence (439 amino acids)

>Psest_0873 HipA N-terminal domain (Pseudomonas stutzeri RCH2)
MERQLNVWINDVLVGVLREFNGLWAFAYSQEWLSRPDAHALSPGLPLQPNEHVDGASVRP
VQWHFDNLLPEEGQRLLIAQSIGAAVADAFSLLQRFGAESAGSLTLLPPGQQPLAGGKQT
LTHEVLSLRIREMPRVPLAERSAKKMSLAGAQHKVAVIYQDGELLEPTGSTPSTHILKPD
HPDIAWGHSAVNEWFVMTLAKRLGLDVPAVSRLYVPQPIYLVERFDRSFTHAQWQRLHCI
DACQLTGLSREYKYSAGSVQKLSDIAKLCVPSVKAREALFKWLVFNALVGNEDAHLKNLS
FLVGRKGVVLAPFYDLLSTAVYGTRAFDQDKWPTQSTLAWPLNGVLCLHEITGAVLIDAG
VGMGIKPATAKKHIDALAGKIYQQATALQNEVQRQNEALSEAQPALRATFNGEMRLLRAI
VEIVIREMASQVSGATGIR