Protein Info for Psest_0869 in Pseudomonas stutzeri RCH2

Annotation: Acetyltransferase (isoleucine patch superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF12464: Mac" amino acids 8 to 59 (52 residues), 59.3 bits, see alignment E=5.2e-20 PF14602: Hexapep_2" amino acids 131 to 166 (36 residues), 36.9 bits, see alignment 3.6e-13 PF00132: Hexapep" amino acids 132 to 166 (35 residues), 41.2 bits, see alignment 1.3e-14

Best Hits

Swiss-Prot: 65% identical to NODL_RHIME: Nodulation protein L (nodL) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00661, maltose O-acetyltransferase [EC: 2.3.1.79] (inferred from 98% identity to psa:PST_3480)

MetaCyc: 51% identical to maltose O-acetyltransferase (Escherichia coli K-12 substr. MG1655)
Maltose O-acetyltransferase. [EC: 2.3.1.79]

Predicted SEED Role

"nodulation protein( EC:2.3.1.79 )"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI68 at UniProt or InterPro

Protein Sequence (182 amino acids)

>Psest_0869 Acetyltransferase (isoleucine patch superfamily) (Pseudomonas stutzeri RCH2)
MAMSEKQKMLAGELYYPGDPEILADQAAAKAWMVRYNAALAASPDERRALLAERLASVGA
GAVIRPPFHCDYGYNIHLGEGAFLNFNCVILDVVEVHIGAGAQIGPAVQLYTADHPRDPE
ARRSGVEFGRPINIGRNVWVGGGAIILPGVTIGDDAVIGAGSVVTRDVPAGATVVGNPAR
IR