Protein Info for PGA1_c00860 in Phaeobacter inhibens DSM 17395

Annotation: cystathionine beta-lyase PatB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 TIGR04350: putative C-S lyase" amino acids 3 to 386 (384 residues), 396.4 bits, see alignment E=6.2e-123 PF00155: Aminotran_1_2" amino acids 39 to 382 (344 residues), 157.6 bits, see alignment E=2.6e-50

Best Hits

KEGG orthology group: K14155, cystathione beta-lyase [EC: 4.4.1.8] (inferred from 77% identity to sil:SPO3220)

Predicted SEED Role

"Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.8

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ET55 at UniProt or InterPro

Protein Sequence (390 amino acids)

>PGA1_c00860 cystathionine beta-lyase PatB (Phaeobacter inhibens DSM 17395)
MNFDKIIDRRNTHCIKWDMMEDLYNVPRDEGLSMWVADMDFAVPSVVTDKMREMADHGVY
GYVNCDSPYKSAICWWMQNRHGWSVDPEAIFTTTGLVNGVGMCLDTFTQQGDGIVLFTPV
YHAFAKVIRNAGREVVECELAVNDGRYEMDFSTYDAQMTGAEKMVILCSPHNPVGRVWTE
EELRGVADFAKRHDLILLSDEIHHDLVFDGATHIPMQNAAPDITDRLLMLTAPSKTFNFA
GMHTGQVIIPDPELRAKFSRRMMALALSPNSPGQWATAAAYSPEGAAWVDELVPYLDGNR
QLFDAAVNEIPGLHSTRLEATYLAWVDFSGTGMSREEFTARVEQGAKIAANHGPSFGTGG
ENFLRFNLGTQRARVEEACDRLRNAFSDLQ