Protein Info for Psest_0853 in Pseudomonas stutzeri RCH2
Annotation: 6-phosphogluconolactonase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 63% identical to 6PGL_PSEPU: 6-phosphogluconolactonase (pgl) from Pseudomonas putida
KEGG orthology group: K01057, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 94% identity to psa:PST_3496)Predicted SEED Role
"6-phosphogluconolactonase (EC 3.1.1.31), eukaryotic type" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 3.1.1.31)
MetaCyc Pathways
- superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
- heterolactic fermentation (15/18 steps found)
- superpathway of glucose and xylose degradation (14/17 steps found)
- Entner-Doudoroff pathway I (8/9 steps found)
- pentose phosphate pathway (7/8 steps found)
- pentose phosphate pathway (oxidative branch) I (2/3 steps found)
- formaldehyde oxidation I (3/6 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 3.1.1.31
Use Curated BLAST to search for 3.1.1.31
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GHG9 at UniProt or InterPro
Protein Sequence (237 amino acids)
>Psest_0853 6-phosphogluconolactonase (Pseudomonas stutzeri RCH2) MTISNLDLPVQTLGFSLGDAEQLAGELALTVSNALRGAITERGAATLVVSGGRSPIAFFE RLAQQELDWTKVTVSLADERWVPVSHPDSNEGLLRRHLLQGPAAAARLVGLYQSAASLEL AAERADAVLTELPPIDVLVLGMGEDGHTASLFPDSPNLQQALDPRGTRRCLPMQAPTVPR QRLSMSLALLASARLTLLALHGRGKLATLNQALAGEPYEAMPIRAFLARPLEIYWCP