Protein Info for Psest_0853 in Pseudomonas stutzeri RCH2

Annotation: 6-phosphogluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 183 to 200 (18 residues), see Phobius details TIGR01198: 6-phosphogluconolactonase" amino acids 19 to 229 (211 residues), 200.3 bits, see alignment E=1.6e-63 PF01182: Glucosamine_iso" amino acids 19 to 235 (217 residues), 188.2 bits, see alignment E=1e-59

Best Hits

Swiss-Prot: 63% identical to 6PGL_PSEPU: 6-phosphogluconolactonase (pgl) from Pseudomonas putida

KEGG orthology group: K01057, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 94% identity to psa:PST_3496)

Predicted SEED Role

"6-phosphogluconolactonase (EC 3.1.1.31), eukaryotic type" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 3.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.31

Use Curated BLAST to search for 3.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHG9 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Psest_0853 6-phosphogluconolactonase (Pseudomonas stutzeri RCH2)
MTISNLDLPVQTLGFSLGDAEQLAGELALTVSNALRGAITERGAATLVVSGGRSPIAFFE
RLAQQELDWTKVTVSLADERWVPVSHPDSNEGLLRRHLLQGPAAAARLVGLYQSAASLEL
AAERADAVLTELPPIDVLVLGMGEDGHTASLFPDSPNLQQALDPRGTRRCLPMQAPTVPR
QRLSMSLALLASARLTLLALHGRGKLATLNQALAGEPYEAMPIRAFLARPLEIYWCP