Protein Info for PGA1_c08510 in Phaeobacter inhibens DSM 17395

Annotation: RNA polymerase sigma factor (ECF01 subgroup, ECF20 subgroup)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF07638: Sigma70_ECF" amino acids 42 to 193 (152 residues), 30.8 bits, see alignment E=5.3e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 50 to 204 (155 residues), 98.6 bits, see alignment E=1.5e-32 PF04542: Sigma70_r2" amino acids 56 to 121 (66 residues), 75.3 bits, see alignment E=5.3e-25 PF08281: Sigma70_r4_2" amino acids 151 to 203 (53 residues), 55.9 bits, see alignment E=5.4e-19 PF04545: Sigma70_r4" amino acids 156 to 203 (48 residues), 32.7 bits, see alignment 8.4e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 79% identity to sit:TM1040_2177)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EK46 at UniProt or InterPro

Protein Sequence (219 amino acids)

>PGA1_c08510 RNA polymerase sigma factor (ECF01 subgroup, ECF20 subgroup) (Phaeobacter inhibens DSM 17395)
MHISANTAERAPEQGPLMPPPDSPATPMAEGVDDPDGALLIRFAAGDPEAAAVLTARLVP
RALGVALRVLGNRAEAEDITQEAMVRLWRQAEHWEPGRARLSTWLYRVVMNLCIDHKRRL
RGGHVDLDAIPDPPDPAKSAAEQMQDGARQDALQDALMQLPERQRQAVVLRHIEDLANPE
IAGIMDISVEAVESLTARGKRALAAILAGRRAELGYSDG