Protein Info for Psest_0847 in Pseudomonas stutzeri RCH2

Annotation: drug resistance transporter, EmrB/QacA subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 268 to 292 (25 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 334 to 352 (19 residues), see Phobius details amino acids 358 to 385 (28 residues), see Phobius details amino acids 398 to 421 (24 residues), see Phobius details amino acids 433 to 454 (22 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 410 (392 residues), 161.4 bits, see alignment E=4.3e-51 amino acids 273 to 465 (193 residues), 50.2 bits, see alignment E=2.9e-17 TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 19 to 418 (400 residues), 260.5 bits, see alignment E=1.5e-81 PF06609: TRI12" amino acids 35 to 269 (235 residues), 27.7 bits, see alignment E=1.5e-10 PF00083: Sugar_tr" amino acids 47 to 117 (71 residues), 26.4 bits, see alignment E=5e-10

Best Hits

Swiss-Prot: 50% identical to MDTD_YERPP: Putative multidrug resistance protein MdtD (mdtD) from Yersinia pestis (strain Pestoides F)

KEGG orthology group: None (inferred from 94% identity to psa:PST_3502)

Predicted SEED Role

"drug resistance transporter, EmrB/QacA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ65 at UniProt or InterPro

Protein Sequence (475 amino acids)

>Psest_0847 drug resistance transporter, EmrB/QacA subfamily (Pseudomonas stutzeri RCH2)
MQSPVSLDARTARVLPWLVAIAFFMQTLDGTILNTALPAMARDLAENPLRMQGVVIAYML
TVALLIPASGWIADRFGSRRIFVTAIVLFSVGSLLCALSTSFNQLVASRVLQGLGGALML
PVGRLVVLRAFPRSEFVRIMAFIALPGLVGPLLGPTLGGWLVEYASWHWIFLINLPVGVI
GCIAALRFMPDLKGPERVRFDTLGFVLFGAAMVLVTIALEGLGHMHMSHARVMLLLVVGA
ACMTAYWLRAGRIDAPLFSPKLFRTRSFAVGIFGNLFARLGGGALPFLLPLLLQVALGYS
PAQAGMSMIPLALGAMAVKSMAKPIIDRLGYRRLLIGNTLLLGGLIASLATIDTQTPTWL
LLVHLGLIGMVNSMQFTAMNTVTLVGLSHADASSGNSLLSVVVQLSMSLGVATAGALLGG
FTVDDAQGSEVLHAFQLTFLCVGGMAMLAAALFLQLEHRDPAKADDPRRPVDVGE