Protein Info for PGA1_c08460 in Phaeobacter inhibens DSM 17395

Annotation: putative fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 81 to 97 (17 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 202 to 218 (17 residues), see Phobius details PF00487: FA_desaturase" amino acids 50 to 287 (238 residues), 114.5 bits, see alignment E=3.8e-37

Best Hits

KEGG orthology group: None (inferred from 60% identity to sit:TM1040_2182)

Predicted SEED Role

"Fatty acid desaturase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EK42 at UniProt or InterPro

Protein Sequence (314 amino acids)

>PGA1_c08460 putative fatty acid desaturase (Phaeobacter inhibens DSM 17395)
MSEQPVIAAARTSVRPQLILGRVEWGTLGLILGCYAAWGASLVWLPLLSFWVAVPVLACL
ITLQSSLSHEALHGHPFPLRVLNEALMFLPLNLAIPYGRFRDTHLAHHHDERLTDPYDDP
ESNFLDPARWRRLGRIMRAVFWLNNTLLGRMLLGPVLGQIRFMADDWRLIRHGDEAVLRD
WLLHLLGAGLTLWLVAQSALPFWAYLLAAYLGLAILKIRTFLEHRAHLDPAARTVIIERG
GVLGFLFLNNNLHVVHHCHPGVPWHDLPKLYQTRRQQFLERNHGYVYPSYGTVFRSYALR
AKDPVAHPIWSQPK