Protein Info for HP15_83 in Marinobacter adhaerens HP15

Annotation: electron transport protein SCO1/SenC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details PF02630: SCO1-SenC" amino acids 31 to 163 (133 residues), 142.1 bits, see alignment E=5.2e-46

Best Hits

KEGG orthology group: K07152, (no description) (inferred from 72% identity to maq:Maqu_3279)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIE2 at UniProt or InterPro

Protein Sequence (190 amino acids)

>HP15_83 electron transport protein SCO1/SenC (Marinobacter adhaerens HP15)
MMLAILLVGCMGDDAPDWHGTDISGVMPKLEFDLIDSQGAPVSGDDYSGQVRMLFFGFTS
CPDVCPTALQKLSQAVSGLSPENQEEVLTLFVSVDPQRDTPERLAEYVNFFGERIVGLTG
KTSDLRTLTQRYRTTFGHEEPDAEGDYAVTHSGAVYVFDREGNPRLLIRPEDLSAQAIRQ
DLVALLEESS