Protein Info for PGA1_c08430 in Phaeobacter inhibens DSM 17395

Annotation: short chain dehydrogenase / reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00106: adh_short" amino acids 9 to 187 (179 residues), 165 bits, see alignment E=3.8e-52 PF01370: Epimerase" amino acids 14 to 243 (230 residues), 25.3 bits, see alignment E=2.4e-09 PF13561: adh_short_C2" amino acids 15 to 248 (234 residues), 186.7 bits, see alignment E=1.3e-58 PF23441: SDR" amino acids 56 to 199 (144 residues), 34.4 bits, see alignment E=4.1e-12

Best Hits

KEGG orthology group: None (inferred from 78% identity to sit:TM1040_2185)

MetaCyc: 44% identical to 2-deoxy-D-ribonate dehydrogenase (Pseudomonas simiae)
1.1.1.M55 [EC: 1.1.1.M55]

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.M55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXH1 at UniProt or InterPro

Protein Sequence (257 amino acids)

>PGA1_c08430 short chain dehydrogenase / reductase (Phaeobacter inhibens DSM 17395)
MSAEGMHRVLITAGGSGIGRAMAEGFAAAGHQVWVTDVSAEALADVPEGWRTTVVDATDE
AGVKGLFAEITVEWGGLDVLCANAGIAGPTALIEDIALEDWRTCVSVNLEGCFLAAKYAA
PMMKAAKAGAIIVTSSTAGQYGYPNRAPYASAKWAVIGLMKTLAMELGPFGIRANVICPG
AVEGPRMEGVLEREAAAKGMTRDQVYEGYASGTSMRSFVEAQDIANMAVFLGSDAARLVS
GQVIAVDGHTENPDPKV