Protein Info for HP15_806 in Marinobacter adhaerens HP15

Annotation: response regulator receiver modulated diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 724 PF00072: Response_reg" amino acids 18 to 127 (110 residues), 93.3 bits, see alignment E=3.9e-30 TIGR00229: PAS domain S-box protein" amino acids 148 to 210 (63 residues), 46.4 bits, see alignment E=4e-16 PF13188: PAS_8" amino acids 153 to 205 (53 residues), 28.6 bits, see alignment 3.5e-10 PF00989: PAS" amino acids 157 to 201 (45 residues), 31.4 bits, see alignment 6e-11 PF08448: PAS_4" amino acids 158 to 251 (94 residues), 30.5 bits, see alignment E=1.3e-10 PF13426: PAS_9" amino acids 162 to 279 (118 residues), 27.3 bits, see alignment E=1.3e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 289 to 451 (163 residues), 145.5 bits, see alignment E=1.2e-46 PF00990: GGDEF" amino acids 292 to 447 (156 residues), 175 bits, see alignment E=3.8e-55 PF00563: EAL" amino acids 469 to 703 (235 residues), 260.2 bits, see alignment E=5.8e-81

Best Hits

KEGG orthology group: None (inferred from 84% identity to maq:Maqu_2223)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PR35 at UniProt or InterPro

Protein Sequence (724 amino acids)

>HP15_806 response regulator receiver modulated diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (Marinobacter adhaerens HP15)
MAPEHTDQPFSHGLTARILVADDEPRLLNTLASLLRSRGYDVAEAHGGRKACELIDQQTF
DLALLDLRMPEVTGFDVMAHLAIGQPDCGVIVVSGESSFSAVSRALRRGALDYIRKPFDP
EELLATVESVIGKKSLLEAHEHIQMRLEKSEALHRYIVNSSPDIVFMLDQDGHFCFVNSK
VESLLGYKPAELCGQHFRHILDDRDVTRGTLALKGPNITADNPRTLEVRLKTRGSRRATR
HFEITAFPIDPQTWPHSGNTQGGGSGNGATYYGTARDVTERKEAEAFINFQAYHDLLTRL
PNRALFKDRLELAITHANRGGQKLAVMFLDLDRFKVINDTLGHAMGDRLLQAVTHRLEKC
LRKGDTLSRFGGDEFTLLLPSIHNHEDARQIAKKLIDALRAPFQLGDHEVFVGVSIGIAI
FPEAGETMDQLIQNADIAMYHVKGKGKDGYRFYSDSMSIDTANRLNLERDLRQALERDEL
RVFYQPQVCSTTNRVVGLEALVRWQHPERGLLYPRDFLPLAEETKLIGQLSERVLDQACQ
DVGRWIQEGHTHLRLAVNLSPIQVEHPRFVETLMQQVKAHNFPAGNLEIEITENVIMNDL
EQISQKLRELAALGVRIAIDDFGTGYSSLNYLHRLPIHTLKVDQSFVKAIRSGDDGACIV
NAIVAMAHGLKLEIVAEGVETDEQLDYLRSLGCHQVQGFFYGPARPAAEISRTLGSTRAK
AASF