Protein Info for Psest_0836 in Pseudomonas stutzeri RCH2

Annotation: Collagenase and related proteases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF01136: Peptidase_U32" amino acids 24 to 266 (243 residues), 48.2 bits, see alignment E=4.4e-17

Best Hits

Swiss-Prot: 51% identical to YHBV_ECOLI: Uncharacterized protein YhbV (yhbV) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to psa:PST_3512)

Predicted SEED Role

"FIG139928: Putative protease" in subsystem CBSS-214092.1.peg.3450

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJD2 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Psest_0836 Collagenase and related proteases (Pseudomonas stutzeri RCH2)
MKLSLGPVLFYWDRQQTLDFYANMAEQPLDVIYLGETVCSKRRALMLDDWLGLARDLAEA
SSAQLVLSGLTLVEAASELSSLRRLCDNGELLVEANDMGAVQLMSERKLPFVGGPALNLY
NGHALAELVASGMSRWVPPVEASGKLIKSARAQLMELDVPLPEIEIFAYGHLPLAYSARC
FTARAENRPKDDCQFCCQNYPEGIPLLSQEGEALFTINGIQTMSAAVSNLLADYAGLVDS
GADLLRLSPRAAGMEDVIAAFDAVRKGALPPLAVDGCNGYWHGQPGMLRAEEAGLC