Protein Info for Psest_0833 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 PF01590: GAF" amino acids 21 to 154 (134 residues), 39.5 bits, see alignment E=2e-13 PF00158: Sigma54_activat" amino acids 186 to 350 (165 residues), 227.3 bits, see alignment E=2.3e-71 PF14532: Sigma54_activ_2" amino acids 187 to 357 (171 residues), 74.6 bits, see alignment E=2.5e-24 PF07728: AAA_5" amino acids 209 to 330 (122 residues), 36.4 bits, see alignment E=1.3e-12

Best Hits

Swiss-Prot: 74% identical to NORR2_CUPNH: Nitric oxide reductase transcription regulator NorR2 (norR2) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 93% identity to psa:PST_3516)

Predicted SEED Role

"Functional role page for Anaerobic nitric oxide reductase transcription regulator NorR" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHE9 at UniProt or InterPro

Protein Sequence (509 amino acids)

>Psest_0833 Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains (Pseudomonas stutzeri RCH2)
MMLADALLADLTTELPNAVRLQRLVHTLQQRFRCGAVVLLRLDEDSLRPLAAVGLVQEAL
GRRFVIAQHPRLAAILSQREPTWFEPDSRLPDPYDGLLDAHIGEPLPVHDCMGVSLYVEG
KLWGALTLDALHAGTFDDDARRDLQRYTLVIEAAVRVTRLEHENRGLRLARSDVMETTLD
HGDGEILGQSDVIRELLRELQVVADSELPVLLLGETGVGKELFARWLHRHSRRRNKPLVH
VNCAALPESLAESELFGHVKGAFSGATTDRPGRFDAANGGTLLLDEVGELPLTVQAKLLR
TLQNGEIQRLGADKPRQVDVRIIAATNRNLRESVRDGHFRADLYHRLSVYPAPIPPLRER
GNDVLILAGHFLELNRARLGLRSMRLSPAAERALLGYSWPGNVRELEHVVSRAALRLLSR
GASRSEILTLEPDLLDLDSHAVGVTASQVVEEPVIADEVLPLRHTVDAAQRQAIVRALEA
SGENWAQAARLLDVDPSNLHKLARRLKLK