Protein Info for Psest_0828 in Pseudomonas stutzeri RCH2

Annotation: Nitric oxide reductase activation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 transmembrane" amino acids 454 to 469 (16 residues), see Phobius details PF00092: VWA" amino acids 427 to 574 (148 residues), 26 bits, see alignment E=4.9e-10

Best Hits

Swiss-Prot: 65% identical to Y525_PSEAE: Uncharacterized protein PA0525 (PA0525) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02448, nitric oxide reductase NorD protein (inferred from 98% identity to psa:PST_3520)

Predicted SEED Role

"Nitric oxide reductase activation protein NorD" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHE4 at UniProt or InterPro

Protein Sequence (613 amino acids)

>Psest_0828 Nitric oxide reductase activation protein (Pseudomonas stutzeri RCH2)
MAFTIEVEEWVGSVWHRFITRRANPDFPEARVELESMQRPLSLLFRAMGGASGVGVEAAS
ARDLLLRRNLLQQVAGTCKQLPVAWCDASNLRLPQSLAVYPEVSLNQDLYRWLALLAAQA
GPMRHWARDNQRWTQAILEQFPAMRPRYQRLVEAHLQLRPDPSQLPKAEAALEAALCQAL
REPGSVSQFPRSERAPWPLPLWLYPADNLGEPQAAQRAEEGEGNLETPPGGESRQRKRAR
RVDESSSKGGLLLFRLENLFSWSEHIELDRCGDDTEDLDAARVAEDLDELALSRQRMRQG
GGLKLDLDLPAADFDDVPLGEGIKLPEWDYRKQCLQKDFVNLQLMLPRGAEAKPLPLHLS
PLARRLRRQFEHLRNDRQWLRQQPQGSELDMQAWLDFHVERQNGQCAERGLFMEQRQNRR
DLACLLLADLSMSTDAHLDNEHRVIDVVIDSLLLFGEALSAVGDPFALYGFSSLRRQQVR
MQELKSFRQPYGDETRGRIQALKPGYYTRMGAAIRQATELLGNCKQRRKLLLLVTDGKPN
DLDLYEGRYGVEDTRQAVMEARKQGLLPFCITIDREAGDYLPYMFGANGYTLIKEPQQLP
FRLPQLYKQLTQS