Protein Info for Psest_0827 in Pseudomonas stutzeri RCH2

Annotation: Nitric oxide reductase large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 202 to 227 (26 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 268 to 295 (28 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 388 to 414 (27 residues), see Phobius details amino acids 434 to 456 (23 residues), see Phobius details PF00115: COX1" amino acids 15 to 445 (431 residues), 249.2 bits, see alignment E=4e-78

Best Hits

Swiss-Prot: 95% identical to NORB_PSEST: Nitric oxide reductase subunit B (norB) from Pseudomonas stutzeri

KEGG orthology group: K04561, nitric oxide reductase, cytochrome b-containing subunit I [EC: 1.7.2.5] (inferred from 98% identity to psa:PST_3521)

MetaCyc: 95% identical to nitric oxide reductase large subunit (Stutzerimonas stutzeri)
NITRIC-OXIDE-REDUCTASE-RXN [EC: 1.7.2.5]

Predicted SEED Role

"Nitric-oxide reductase subunit B (EC 1.7.99.7)" in subsystem Denitrification (EC 1.7.99.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.2.5, 1.7.99.7

Use Curated BLAST to search for 1.7.2.5 or 1.7.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ42 at UniProt or InterPro

Protein Sequence (474 amino acids)

>Psest_0827 Nitric oxide reductase large subunit (Pseudomonas stutzeri RCH2)
MSIINPHLKFQSQAVAKPYFVFALILFVGQILFGLIMGLQYVIGDFLFPLLPFNVARMVH
TNLLIVWLLFGFMGAAYYLIPEEADRELHSPKLAIILFWVFAAAGVLTILGYLFVPYAGL
AEMTKNELLPTMGREFLEQPTITKIGIVVVALGFLYNVGMTMLKGRKTVVSTVMMTGLIG
LAVFFLFSFYNPENLARDKYYWWFVVHLWVEGVWELIMGSMLAFVLIKITGVDREVVEKW
LYVIIAMALITGIIGTGHHFFWIGAPTVWLWLGSIFSALEPLPFFAMVLFSLNMVNRRRR
EHPNKAASLWAIGTTVTAFLGAGVWGFLHTLAPVNYYTHGSQLTAAHGHLAFYGAYAMIV
MTMISYAMPRLRGLGEAPDARAQRIEVWGFWLMTISMVAITLFLTAAGVVQVWLQRIPAD
GAAMSFMNTADQLAIFFWLRLIAGVFFLIGLVCYLYSFRQRGRVPVVAAAAAAA