Protein Info for Psest_0826 in Pseudomonas stutzeri RCH2

Annotation: Cytochrome c

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 49 to 129 (81 residues), 26.3 bits, see alignment E=7.6e-10 PF00034: Cytochrom_C" amino acids 50 to 132 (83 residues), 61.5 bits, see alignment E=1.5e-20

Best Hits

Swiss-Prot: 97% identical to NORC_PSEST: Nitric oxide reductase subunit C (norC) from Pseudomonas stutzeri

KEGG orthology group: K02305, nitric oxide reductase, cytochrome c-containing subunit II (inferred from 99% identity to psa:PST_3522)

MetaCyc: 97% identical to nitric-oxide reductase small subunit (Stutzerimonas stutzeri)
NITRIC-OXIDE-REDUCTASE-RXN [EC: 1.7.2.5]

Predicted SEED Role

"Nitric-oxide reductase subunit C (EC 1.7.99.7)" in subsystem Denitrification (EC 1.7.99.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.2.5, 1.7.99.7

Use Curated BLAST to search for 1.7.2.5 or 1.7.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJC1 at UniProt or InterPro

Protein Sequence (146 amino acids)

>Psest_0826 Cytochrome c (Pseudomonas stutzeri RCH2)
MSETFTKGMARNIYFGGSVFFFLVFLGLTYHTEQTFPERTNESEMTEAVVRGKAVWENNN
CIGCHSLLGEGAYFAPELGNVFVRRGGEEAFKPFLHAWMKAQPLGAPGRRAMPQFNLTEQ
QVDDMAEFLKWTSKIDTNNWPPNREG