Protein Info for Psest_0825 in Pseudomonas stutzeri RCH2

Annotation: transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF22451: NirdL-like_HTH
  • amino acids 14 to 59 (46 residues), 46.7 bits, E=1.8e-16
• PF17805: AsnC_trans_reg2
  • amino acids 69 to 156 (88 residues), 86.6 bits, E=1e-28

Best Hits

Swiss-Prot: 96% identical to NIRH_PSEST: Protein NirH (nirH) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 91% identity to psa:PST_3523)

MetaCyc: 56% identical to siroheme decarboxylase NirH subunit (Paracoccus pantotrophus)
RXN-15805 [EC: 4.1.1.111]

Predicted SEED Role

"Heme d1 biosynthesis protein NirH" in subsystem Dissimilatory nitrite reductase or Heme biosynthesis orphans

MetaCyc Pathways

• heme d₁ biosynthesis (2/3 steps found)
• heme b biosynthesis III (from siroheme) (1/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.111

Sequence Analysis Tools

See L0GF92 at UniProt or InterPro

Protein Sequence (168 amino acids)

>Psest_0825 transcriptional regulator, AsnC family (Pseudomonas stutzeri RCH2)
MSVCTSPSDEGLTRRLIELTEAGLPLVADPWAWLADELGIDVDATLELLQRLQADGAIRR
IAAIPNHYRLGYRHNGMTVWDVDDDEIARLGALIGAQPFVSHCYRRPRQEGWPYNLFAMV
HGRDASDIEAYRNQIRALLGGACRANEMLVSSRILKKTGLRLAGQRRA