Protein Info for PGA1_c08250 in Phaeobacter inhibens DSM 17395

Annotation: putative glycerol-3-phosphate regulon repressor glpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF08220: HTH_DeoR" amino acids 6 to 61 (56 residues), 61.7 bits, see alignment E=8.6e-21 PF08279: HTH_11" amino acids 6 to 47 (42 residues), 29.9 bits, see alignment 8.1e-11 PF00455: DeoRC" amino acids 74 to 232 (159 residues), 166.2 bits, see alignment E=1.2e-52

Best Hits

Swiss-Prot: 38% identical to GLPR_HAEIN: Glycerol-3-phosphate regulon repressor (glpR) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02444, DeoR family transcriptional regulator, glycerol-3-phosphate regulon repressor (inferred from 79% identity to sit:TM1040_2205)

Predicted SEED Role

"Glycerol-3-phosphate regulon repressor, DeoR family" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EUZ5 at UniProt or InterPro

Protein Sequence (261 amino acids)

>PGA1_c08250 putative glycerol-3-phosphate regulon repressor glpR (Phaeobacter inhibens DSM 17395)
MDATDRQAAILDLLTRQDRVEVEDLAQRFGVSLQTIRTDLRDLAARGALSRVHGGAVRSS
SGASRDYAERRKLNARGKRAMAALAADLIPDNCAITLNIGTSTEQVARALSGHRGLTVLS
NNINIINMMMEDESKELVLVGGAIRQSDGAIVGEDALEFIARYKVDIAVIGASAMDADGA
ILDHDPREVSVARAILKNARKRVLVCDGSKFERTAPVRICDISDLDVVVTDRPVPAEFSR
AAKAAGTQILWVGENESSENV