Protein Info for Psest_0822 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF22451: NirdL-like_HTH" amino acids 8 to 50 (43 residues), 50.1 bits, see alignment E=1.6e-17 PF17805: AsnC_trans_reg2" amino acids 66 to 139 (74 residues), 67.6 bits, see alignment E=8.9e-23

Best Hits

Swiss-Prot: 95% identical to NIRD_PSEST: Protein NirD (nirD) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 93% identity to psa:PST_3526)

Predicted SEED Role

"Heme d1 biosynthesis protein NirD" in subsystem Dissimilatory nitrite reductase or Heme biosynthesis orphans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ38 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Psest_0822 Transcriptional regulators (Pseudomonas stutzeri RCH2)
MHIDALSRRLIDRYQHGMPLCAEPYRAMAEELGCSEDEVLVCLEQLQDGGGLSRIGPVFE
HSRAGASTLVALAVPEARLEQVAARINAFPEVNHNYLREHRYNLWFVLTGPDRPHIDRLL
AEIEADTGLTPLDLPMLHAFRIDLGFPLGDPS