Protein Info for Psest_0821 in Pseudomonas stutzeri RCH2

Annotation: Cytochrome D1 heme domain.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF02239: Cytochrom_D1" amino acids 24 to 385 (362 residues), 488.7 bits, see alignment E=3.9e-151

Best Hits

Swiss-Prot: 96% identical to NIRF_PSEST: Protein NirF (nirF) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 95% identity to psa:PST_3527)

MetaCyc: 55% identical to heme d1 dehydrogenase (Paracoccus pantotrophus)
1.1.1.-

Predicted SEED Role

"Heme d1 biosynthesis protein NirF" in subsystem Dissimilatory nitrite reductase

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJB5 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Psest_0821 Cytochrome D1 heme domain. (Pseudomonas stutzeri RCH2)
MIRPFLLLAAAGLLAACAQQPLRGTGDLGVVVERATGSLQIIESTNQSQLARVEGLGDLS
HASVVFSRDQRYAYVFGRDGGLTKVDLLRQRIDRRVIQGGNSIGGAISQDGTLIAVGNYE
PGGVKVFNANTLELVADIPATPLADGSRNARVVGVIDVPGRRFIYSLFDTDETWLLDFSQ
GNEPQITRFEGIGRQPYDALLTPEGRYYIAGLFGEDGMAKIDLWHPERGVERILDGYGRG
QQKLPVYKMPHLEGWTVAGNQTFVPAVGQHRVLVMDSEKWQQTDAIDVAGQPIFVMARPD
ARQIWVNFAHPDNGKVQVIDSETHEIIADLEPGPAVLHMEFTARGDQLWLSVRDGEEIQV
WDPYTLKLLKRLPAHSPSGIFFSSRAHETGL