Protein Info for HP15_786 in Marinobacter adhaerens HP15

Annotation: DNA repair protein RecO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF11967: RecO_N" amino acids 5 to 77 (73 residues), 68.9 bits, see alignment E=3.1e-23 TIGR00613: DNA repair protein RecO" amino acids 12 to 220 (209 residues), 90.3 bits, see alignment E=6.7e-30 PF02565: RecO_C" amino acids 88 to 229 (142 residues), 50.8 bits, see alignment E=1.7e-17

Best Hits

Swiss-Prot: 67% identical to RECO_MARHV: DNA repair protein RecO (recO) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03584, DNA repair protein RecO (recombination protein O) (inferred from 67% identity to maq:Maqu_2243)

Predicted SEED Role

"DNA recombination and repair protein RecO" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQK7 at UniProt or InterPro

Protein Sequence (242 amino acids)

>HP15_786 DNA repair protein RecO (Marinobacter adhaerens HP15)
MKGPELQEPAYVLHRRPWRETSLMVDLFSLNHGRMTVIARGANSAKSPLKAQLQPFQPLI
VDWAGRGDLKTLTQVDVRAGPTITRTVSLYSGLYLNELLQRILPAADPHPTLFAAYIDAI
GQLSDTRDVEPVLRRFELAFASALGYDFAWDRATDTGQSVEPGGEYCYDPEQGIVSGLSP
GVRLRHLPGDVLLNLAAEDLQSERCRRLAKRVMRVLIDYLLQGRPLNSRSLFIHLRGESH
ES