Protein Info for PGA1_c08180 in Phaeobacter inhibens DSM 17395

Annotation: cobalamin biosynthesis protein CobW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR02475: cobalamin biosynthesis protein CobW" amino acids 5 to 357 (353 residues), 510.8 bits, see alignment E=7.2e-158 PF02492: cobW" amino acids 8 to 202 (195 residues), 186.7 bits, see alignment E=3e-59 PF07683: CobW_C" amino acids 269 to 358 (90 residues), 59.1 bits, see alignment E=3.1e-20

Best Hits

Swiss-Prot: 47% identical to COBW_PSEAE: Protein CobW (cobW) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02234, cobalamin biosynthesis protein CobW (inferred from 68% identity to rde:RD1_3828)

Predicted SEED Role

"CobW GTPase involved in cobalt insertion for B12 biosynthesis" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXE7 at UniProt or InterPro

Protein Sequence (359 amino acids)

>PGA1_c08180 cobalamin biosynthesis protein CobW (Phaeobacter inhibens DSM 17395)
MSDLNKIPVTVITGFLGAGKTTLIRHLMQNPQGKRLAVVVNEFGTAGVDGEILKSCADEN
CPAENIMELANGCICCTVADDFIPTIEQLMNLPEKPDHIVIETSGLALPKPLLKAFDWPA
IRSRITVDGVVALADAEAVAKGQFATDLEAVQAQREADEGIDHETPLSELFKDQISCADI
ILLSKADLAGEEGLDKARTMIEAEAPRKLPILSMSEGVIDPRVILGLEAAAEDDLDARPS
HHEHHHHHDDDHGDDHHHHDHDHSHDDFDTIVVEMGEVSDPQLLQDAIVKLARERNILRV
KGYVAVEGKPMRMLVQAVGERLRAQYDQPWGAQARKTVLVVIAEHDNIDAEAIRAELGA