Protein Info for PGA1_c08160 in Phaeobacter inhibens DSM 17395

Annotation: putative precorrin-3B synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02435: precorrin-3B synthase
  • amino acids 14 to 355 (342 residues), 260.1 bits, E=1.7e-81
• PF03460: NIR_SIR_ferr
  • amino acids 22 to 87 (66 residues), 65.6 bits, E=1.4e-22

Best Hits

KEGG orthology group: K02229, precorrin-3B synthase [EC: 1.14.13.83] (inferred from 70% identity to sit:TM1040_2211)

Predicted SEED Role

"Cobalamin biosynthesis protein CobG" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (28/33 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (13/13 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.83

Sequence Analysis Tools

See I7EK14 at UniProt or InterPro

Protein Sequence (392 amino acids)

>PGA1_c08160 putative precorrin-3B synthase (Phaeobacter inhibens DSM 17395)
MTGQAASSPPKVYGWCPGALRPMMSGDGLVVRVRAPLGRLTPEQARGLAELSQHYGSGLV
DISARANLQLRGIREDAHRALIAGLRDLDLVDEDAEAEARRNITLTPFWQAGDVSHLIAL
DLAAALTEATDLTLPGKFGFAVDCGAAPVLTDTAADIRIERGPDGLLLRADGADTGLPVT
AEAAAGEALALARWFLDQGGASEGRGRMHQLIARRTPPTVHVAAVPDATQIYPQQPGATT
SGLLVALEFGQMPARTLAALADHGALRLTPWRMLLVEDISSLPPLPGLILDATDPRLRVS
ACTGAPGCPQARAVTRDLARDLAAAVPVGQHLHISGCAKGCAHPRPADLVLTATNTDRFD
LIRNGTAADHPLNTSLSADALRAAPELLTEGS