Protein Info for Psest_0815 in Pseudomonas stutzeri RCH2

Annotation: Cytochrome c, mono- and diheme variants

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 37 to 120 (84 residues), 33 bits, see alignment E=9.2e-12 PF00034: Cytochrom_C" amino acids 38 to 123 (86 residues), 31.5 bits, see alignment E=5.2e-11 PF02239: Cytochrom_D1" amino acids 157 to 555 (399 residues), 528.6 bits, see alignment E=9.4e-163

Best Hits

Swiss-Prot: 91% identical to NIRS_PSEST: Nitrite reductase (nirS) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 99% identity to psa:PST_3532)

MetaCyc: 91% identical to NirS (Stutzerimonas stutzeri)
Nitrite reductase (NO-forming). [EC: 1.7.2.1]

Predicted SEED Role

"Cytochrome cd1 nitrite reductase (EC:1.7.2.1)" in subsystem Denitrification or Dissimilatory nitrite reductase or Heme biosynthesis orphans (EC 1.7.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.2.1

Use Curated BLAST to search for 1.7.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GF81 at UniProt or InterPro

Protein Sequence (560 amino acids)

>Psest_0815 Cytochrome c, mono- and diheme variants (Pseudomonas stutzeri RCH2)
MSNVGKPILAGLIAGLSLLGLAVAQAAAPEMTAEEKEAAKQIYFERCAGCHGVLRKGATG
KNLEPHWSKTEADGKKTEGGTLNLGTKRLENIIAYGTEGGMVNYDDILTKEEINMMARYI
QNTPDVPPEFSLQDMKDSWKLIVPVDQRPKKQMNKINLKNVFAITLRDAGKLALVDGDTH
TIWKVLDTGYAVHISRLSASGRYVYTVGRDGLTTIIDMWYEEPTTVATVRLGSDARSVDT
SKFKGYEDKYLIGGTYWPPQYSIMDGETLEPIKVVSTRGQTVDGEYHPEPRVASIVASHI
KPEWVVNVKETGQIILVDYTDLKNLKTTTIESAKFLHDGGWDYSKRYFMVAANASNKVAA
VDTKTGKLAALVDTAKIPHPGRGANFIHPQFGPVWTTGHLGDDVVSLISTASDDPKYAKY
KEHNWKVVQELKMPGAGNLFVKTHPKSKNLWADAPMNPEREVAESVYVYDLADLSKEPKR
LDVAKDSGLPESKAIRRATHPEYNEAGNEVWISLWGGKTDQSAIVIYDDKTLKLKKVITD
PAIITPTGKFNVFNTMYDVY