Protein Info for PGA1_c08120 in Phaeobacter inhibens DSM 17395

Annotation: precorrin-6A reductase CobK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 66% identical to COBK_RHOCB: Precorrin-6A reductase (cobK) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K05895, precorrin-6X reductase [EC: 1.3.1.54] (inferred from 66% identity to rcp:RCAP_rcc02043)

MetaCyc: 47% identical to precorrin-6A reductase (Pseudomonas denitrificans (nom. rej.))
Precorrin-6A reductase. [EC: 1.3.1.54]

Predicted SEED Role

"Cobalt-precorrin-6x reductase (EC 1.3.1.54)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 1.3.1.54)

MetaCyc Pathways

adenosylcobalamin biosynthesis II (aerobic) (28/33 steps found)
cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (13/13 steps found)
cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (11/15 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (24/36 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DYJ5 at UniProt or InterPro

Protein Sequence (246 amino acids)

>PGA1_c08120 precorrin-6A reductase CobK (Phaeobacter inhibens DSM 17395)
MTRILLLGGTTEASQLAKTLAEAGADAVFSYAGRTAKPVSQPLPTRVGGFGGVERLSEYL
KAESITHVVDATHPFAAQMSTNAVHACEATDVKLCAFERPAWQAGEGDTWVHAGTIDEAV
NALPDAAARVFLAIGKQNLTQFAVKPQHHYLLRLVDEPDAPLPLPHTTVEIARGPFDAAG
DTALMQRHGITHVVAKNAGGAGAAAKLIAARTLGLPVIMIGRPDVPARPIKGSVAEVMAW
LSHSAA