Protein Info for PGA1_c08080 in Phaeobacter inhibens DSM 17395

Annotation: putative cobyrinic acid A,C-diamide synthase CobB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01656: CbiA
  • amino acids 14 to 199 (186 residues), 61.6 bits, E=1.1e-20
• TIGR00379: cobyrinic acid a,c-diamide synthase
  • amino acids 14 to 437 (424 residues), 300.1 bits, E=1.4e-93
• PF07685: GATase_3
  • amino acids 252 to 441 (190 residues), 113.1 bits, E=2e-36

Best Hits

Swiss-Prot: 67% identical to COBB_RHOCB: Hydrogenobyrinate a,c-diamide synthase (cobB) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 86% identity to sit:TM1040_2219)

MetaCyc: 52% identical to CobB (Pseudomonas denitrificans (nom. rej.))
Hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolyzing). [EC: 6.3.5.9]

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (28/33 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (13/13 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (11/15 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (24/36 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Sequence Analysis Tools

See I7EXD7 at UniProt or InterPro

Protein Sequence (443 amino acids)

>PGA1_c08080 putative cobyrinic acid A,C-diamide synthase CobB (Phaeobacter inhibens DSM 17395)
MADPMTDMNPPGLMISAPSSGTGKTTVMLGLLRALAEDGLVVQPYKSGPDYIDPAFHLAA
AGRPSFNLDTWAMDAGLLDAVTGQAAGAEICIGEGSMGLYDGVATRGQSGFGSSAETAKR
MGWPVVLVVDVGGQAQSAAATALGFKNYDTEVPFAGVILNRVASPRHERLTRLGMEKAGI
KVLGSLPRRGDLALPERHLGLIQAVEHPDLEAAIAGYAAFLRENVDLEAIKSAALAGAAP
AAAKLPLPPAQRIALARDAAFSFTYPHLLTGWRAAGAEILPFSPLADEAPAADADLVWLP
GGYPELHGGTLAAAETFRAGLRKHAETKPVHGECGGYMALGEALIDKEGNRHQMAGLLGL
VTSYEKRKFHLGYRRAVLQAGMPGFAAGTALRGHEFHYSTILDEPDAPLANVMDADGNPV
PETGSIKGHVTGTFFHLITGEQA