Protein Info for PGA1_c00810 in Phaeobacter inhibens DSM 17395

Annotation: putative lytic murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13406: SLT_2" amino acids 26 to 315 (290 residues), 294.1 bits, see alignment E=1.1e-91 TIGR02283: lytic murein transglycosylase" amino acids 26 to 319 (294 residues), 325.3 bits, see alignment E=1.8e-101 PF01471: PG_binding_1" amino acids 337 to 390 (54 residues), 38.2 bits, see alignment 1.3e-13

Best Hits

KEGG orthology group: None (inferred from 72% identity to sit:TM1040_2586)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ET52 at UniProt or InterPro

Protein Sequence (390 amino acids)

>PGA1_c00810 putative lytic murein transglycosylase (Phaeobacter inhibens DSM 17395)
MLRPSILALVSFLLPLQAHAQCGGGFRNFVQLMKEEALTGGYDSATVNRFFENVRQDPAV
LKADRAQGVFQKPFIEFSRRLISKSRLDRGQAMSRKYDATFRRIETTYGIDRSVLLAFWA
FETDYGAVQGNFNTLNALVTLAHDCRRPELFRPQVFAALELFRQDNFDPRRTTGAWAGEI
GMVQMLPGDILENGVDADGDGHVSLKTSAPDALMSGAKMLSHLGWHPNEPWLQEVTIPAD
LDLSLSGVHHKKTVADWQALGISPRDGRLADRGTKAALILPQGHKGPAFLAYPNFDVYFE
WNQSFTYVLTAAYFATRLSGAATYNAGTPDTGLAAKQMEQLQRKLKARGHDVGDVDGILG
AKTRVAVQKEQKRLGLPADAWPTPALLSRL