Protein Info for Psest_0801 in Pseudomonas stutzeri RCH2

Annotation: CBS-domain-containing membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 84 to 118 (35 residues), see Phobius details amino acids 124 to 140 (17 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details PF04982: TM_HPP" amino acids 22 to 173 (152 residues), 120.1 bits, see alignment E=6.7e-39 PF00571: CBS" amino acids 241 to 294 (54 residues), 45.3 bits, see alignment 8.9e-16 amino acids 315 to 368 (54 residues), 55.3 bits, see alignment 6.5e-19

Best Hits

KEGG orthology group: K07168, CBS domain-containing membrane protein (inferred from 79% identity to psa:PST_3540)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ97 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Psest_0801 CBS-domain-containing membrane protein (Pseudomonas stutzeri RCH2)
MHDNLIDWFRSFVPAPFNAAPKEWLRAAGGIAIVMLLSVFSGFLLFGVPLTLQLIAPAGA
SAVLLFAASSSPFAQPWSVLGGNLLATVIGVSLGLTSLPSMAAAALCVCLVLVGLFSLRC
LHPPGAALALVAVVGCPEIHHLGYGLLYPVAFNSLLLLAVALLYNNLTRHPYPKPRLPRE
NVHRTRDPQPSERMSFSHDDVDRALREFGEYVDVTRDDLERLIKQTEKHALRRSMGEVTA
ADIMSRDVYSHTPDTFIEQAWSTLQRNRLRSLPVVSDARELVGIVTLVDLLKHFHPRPGR
LNFGQLKFLRGTKLRAIMSSPVVSVTPDTHMVELVYLLSDRGLHCLPVVDGERRLVGMIT
QTDLIAALYRNWLRHLPD