Protein Info for Psest_0799 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein involved in response to NO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 94 to 110 (17 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details PF05940: NnrS" amino acids 14 to 390 (377 residues), 354.9 bits, see alignment E=3.4e-110

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 94% identity to psa:PST_3544)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHX9 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Psest_0799 Uncharacterized protein involved in response to NO (Pseudomonas stutzeri RCH2)
MQVIDRRKALSIPPIWRLAFRPFFLAGAVYALLAIPLWVATWTGHWPGFQPTGGWLAWHR
HEMLFGFAMAIVAGFLLTAVQTWTGQTAPSGKRLMGLALVWLAARLGWLFGLPAEWLAPL
DLLFLLALAWMMARMLWAVRQKRNYPIVVVLSLMFGADVLTLTGLLQGNDALQRQGVLAG
LWLVAALMALIGGRVIPFFTQRGLGKVEAVKPWVWLDIALLVGTGVIALLHAFGVAMRPQ
PLLGLLFVAIGVGHLLRLARWYDKGIWKVGLLWSLHMAMLWLVVAAFGLALWHFGLLAQS
SPSLHALSVGSMSGLILAMIARVTLGHTGRPLQLPAGIVGAFVLFNLGTAARVFLSVVWP
VGGLWLAATCWGLAFALYVWRYAPMLVAARVDGHPG