Protein Info for PGA1_c07900 in Phaeobacter inhibens DSM 17395

Annotation: alpha-glucoside transport ATP-binding protein AglK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF00005: ABC_tran" amino acids 20 to 162 (143 residues), 119.3 bits, see alignment E=3.9e-38 PF17912: OB_MalK" amino acids 237 to 289 (53 residues), 37.1 bits, see alignment 1e-12 PF08402: TOBE_2" amino acids 282 to 354 (73 residues), 26.9 bits, see alignment E=8.3e-10

Best Hits

Swiss-Prot: 65% identical to AGLK_RHIME: Alpha-glucoside transport ATP-binding protein AglK (aglK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10235, alpha-glucoside transport system ATP-binding protein (inferred from 85% identity to sit:TM1040_3303)

Predicted SEED Role

"Alpha-glucoside transport ATP-binding protein AglK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJZ2 at UniProt or InterPro

Protein Sequence (363 amino acids)

>PGA1_c07900 alpha-glucoside transport ATP-binding protein AglK (Phaeobacter inhibens DSM 17395)
MANLKLTNVAKTYGGGVEVLRDINLDIKQGELIVFVGPSGCGKSTLLRMIAGLERISGGT
LEIDNAVMNDIPPAQRGIAMVFQSYALYPHMTVRDNMAFALKIAKKSKDEIDAAIDRAAK
ILQLEPYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRIEIAQL
KEAMPDSTMIYVTHDQVEAMTLASRIVVLADKGIAQVGTPLDLYQRPENEFVAQFIGSPA
MNLIPGTVVATGPRTTVRLTSGEEVVAEIPTTDADQGLAVNVGVRPEDLVEEGTGGALID
SRVDIVEALGEVTVLYIAAGEGKDPLIAKLPGIHKGLRGSSVRLYADPARLHLFHNGQSL
LYR