Protein Info for PGA1_c07890 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): cytoplasmic trehalase (AlgA)
Rationale: Specifically important for trehalose utilization and part of an operon with an algEFGK-type transporter for trehalose and cellobiose. Also important for cellobiose utilization, but this may be a polar effect (the cellobiase is PGA1_c07840)
Original annotation: putative alpha-glucosidase AglA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 PF00128: Alpha-amylase" amino acids 42 to 388 (347 residues), 304.3 bits, see alignment E=1.5e-94 PF11941: DUF3459" amino acids 460 to 548 (89 residues), 29.7 bits, see alignment E=7.3e-11

Best Hits

Swiss-Prot: 69% identical to AGLA_RHIME: Probable alpha-glucosidase (aglA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01187, alpha-glucosidase [EC: 3.2.1.20] (inferred from 79% identity to sit:TM1040_3304)

Predicted SEED Role

"Alpha-glucosidase AglA"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EUW4 at UniProt or InterPro

Protein Sequence (552 amino acids)

>PGA1_c07890 cytoplasmic trehalase (AlgA) (Phaeobacter inhibens DSM 17395)
MNAQAQLDPAQVLAADPDWWRGAVIYQIYPRSYQDSNGDGIGDLRGITQRLPHIASLGVD
AIWISPFFTSPMKDFGYDVSDYCDVDPMFGSLSNFDQLVAAAHRLGLRVMIDLVLSHTSD
QHAWFGESRQSRDNARADWYVWADPQPDGTPPNNWLSIFGGSAWQWDPRREQYYLHNFLV
SQPDLNFHSPAVQDALLDVTRFWLERGVDGFRLDTINFYYHDAELRSNPALPPEQRNATI
APSVNPYNHQEHLYSKNQPENLAFLGRFRALLDEYPAKAAVGEVGDAQRGLEIMGSYTAA
NTGVHMCYAFELLAKDVLTASRLAEVFAEVDRVAANGWACWAFSNHDVIRHSSRWGLNPA
AQRLFTTMMMCLRGTTCIYQGEELGLPEADIAFEDLQDPYGIEFWPEFKGRDGCRTPMVW
EPSNGSGGFSAGKPWLPVSPEHLNLSVASQEADPDAMLHHYRRAIALRKAHPALAVGTHD
QLRAEGNVAFFTRQDRDEVIFCAFNLGDIPAEITLPEGTWRKPDTDIALADLPQSGARVV
LAPWQACLAVRV