Protein Info for Psest_0788 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF22752: DUF488-N3i
  • amino acids 1 to 125 (125 residues), 169.3 bits, E=9.3e-54
• PF22751: DUF488-N3a
  • amino acids 2 to 115 (114 residues), 81.9 bits, E=7e-27
• PF04343: DUF488
  • amino acids 4 to 111 (108 residues), 96.5 bits, E=2.6e-31

Best Hits

KEGG orthology group: None (inferred from 76% identity to psa:PST_3555)

Predicted SEED Role

"probable uroporphyrin-III c-methyltransferase (EC 2.1.1.107)" (EC 2.1.1.107)

MetaCyc Pathways

• siroheme biosynthesis (4/4 steps found)
• factor 430 biosynthesis (3/7 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (21/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (20/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (3/13 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (4/15 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.107

Use Curated BLAST to search for 2.1.1.107

Sequence Analysis Tools

See L0GHA1 at UniProt or InterPro

Protein Sequence (139 amino acids)

>Psest_0788 Uncharacterized conserved protein (Pseudomonas stutzeri RCH2)
MIRCKRAYLPADPEDGQRVLVDRLWPRGLRKDNLALHAWLADLAPSVELRKAFKGGAMQF
DEFSRRYRGELAAHPEHWWPLLELAERGTLTLVYAARDEQQNNARVLAEWLEQEGERFER
PSSPAYMAGELRRRLSDDD