Protein Info for PGA1_c07870 in Phaeobacter inhibens DSM 17395

Annotation: alpha-glucoside transport system permease protein AglF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 305 to 328 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 125 to 325 (201 residues), 48.8 bits, see alignment E=3.5e-17

Best Hits

Swiss-Prot: 64% identical to AGLF_RHIME: Alpha-glucoside transport system permease protein AglF (aglF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10233, alpha-glucoside transport system permease protein (inferred from 91% identity to sit:TM1040_3306)

Predicted SEED Role

"ABC alpha-glucoside transporter, inner membrane subunit AglF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXB9 at UniProt or InterPro

Protein Sequence (335 amino acids)

>PGA1_c07870 alpha-glucoside transport system permease protein AglF (Phaeobacter inhibens DSM 17395)
MHPAIQGLFTIAFGVGGCVGYFYFSNLVLDRVIFPARGAHIARNIRRANMIRPWLFLFPA
LLALGLYLAYPVVETLRLSVTERVPGGGSEFVGLANYQQMLAEAKFWEALQNNFLWLLVV
PAASTAFGLLAAQLTDRLAWGNIAKSLIFMPMAISFVGAAVIWKLVYDARPEGTDQIGVL
NALYIYFGGDGPMQWLTIPFWNSFFLMMVLIWIQTGFAMVILSAALRGIPEETVEAAIVD
GAGPFQIFFKIKVPQIMDTIVVVWTTITIVVLKVFDIVFAMTNGQWETQVLANYMYDKLF
RANDWGVGSASAMVIMLLVLPILVWNVYNARREMR