Protein Info for PGA1_c07860 in Phaeobacter inhibens DSM 17395

Annotation: alpha-glucosides-binding periplasmic protein AglE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01547: SBP_bac_1" amino acids 65 to 265 (201 residues), 53.9 bits, see alignment E=2.9e-18 PF13416: SBP_bac_8" amino acids 70 to 390 (321 residues), 39.1 bits, see alignment E=8e-14

Best Hits

Swiss-Prot: 63% identical to AGLE_RHIME: Alpha-glucosides-binding periplasmic protein AglE (aglE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10232, alpha-glucoside transport system substrate-binding protein (inferred from 84% identity to sit:TM1040_3307)

Predicted SEED Role

"Alpha-glucosides-binding periplasmic protein AglE precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DYH7 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PGA1_c07860 alpha-glucosides-binding periplasmic protein AglE (Phaeobacter inhibens DSM 17395)
MKRSLLAAAGVLALSAGLAQAEGALTFPVGEGEFNWESFEALKATDLSGEQVTVFGPWLG
PDQELVEKVLAYFAEATGADVRYTGSDSFEQQIVVDAEAGSAPNVAVFPQPGLVSDMAAR
GFIAPLGSETADWVRENYAAGDSWVDLSTFTGPDGNEDVFGLFYKVDVKSLVWYVPETFE
DFGYDIPQSMEELKALTDQMVADGNTPWCIGLGSGGATGWPATDWVEDMMLRTQDPGVYD
QWVSNEIPFTDPRVVNAIEEFGYFARNDDYVSGGAGAVASTDFRDSPKGLFASPPQCLMH
RQASFIPAFFPEGTEVGLDADFFYFPAYAEKDLGSPVLGAGTLWSITNDSKGARALMEFL
KSPIGHEVWMAQQGFLTPHKGVNTDVYATDTLKKMGEILLSADTFRFDASDLMPGGVGAG
SFWTGMVGYAGGTPAEEVAAEIQSSWDALK