Protein Info for Psest_0784 in Pseudomonas stutzeri RCH2

Annotation: L-serine dehydratase, iron-sulfur-dependent, single chain form

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF03315: SDH_beta" amino acids 4 to 156 (153 residues), 201.7 bits, see alignment E=8.3e-64 TIGR00720: L-serine ammonia-lyase" amino acids 4 to 455 (452 residues), 715.4 bits, see alignment E=1.5e-219 PF03313: SDH_alpha" amino acids 187 to 452 (266 residues), 314.4 bits, see alignment E=7.1e-98

Best Hits

Swiss-Prot: 52% identical to SDHL_HAEIN: L-serine dehydratase (sdaA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 88% identity to psa:PST_3559)

Predicted SEED Role

"L-serine dehydratase (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHW3 at UniProt or InterPro

Protein Sequence (458 amino acids)

>Psest_0784 L-serine dehydratase, iron-sulfur-dependent, single chain form (Pseudomonas stutzeri RCH2)
MSLSVFDLFKIGIGPSSSHTVGPMRAALLFAEGLRQDQLLATTDHLKVELYGSLGATGKG
HGSDKAVLLGLEGERPERVDTTNIPQRMAAIRETCALRLLGEKSIRFDVGHDLQFIRKPL
AFHPNGMVFRAFDAAGLQVRSREYYSVGGGFVIDENATGNDRIVEDATPLPYPFHSAAQL
LAHCTAHSLTISELMLANETVWRPQGETRAGLLRIWQVMQDCVEAGCRTEGVMPGGLKVR
RRAAGLYRQLSEHPEANLRDALNVLDWVDLYALAVNEENASGGRVVTAPTNGAAGIIPAL
LHYYMRFVPGADEDGVVRFLLTAAAIGMLYKENASISGAEVGCQGEVGVACSMGAGALCE
VLGGTPQQVENAAEIGMEHNLGLTCDPVGGLVQVPCIERNAMGAVKAINAARMALRGDGS
HFISLDKVIRTMRQTGADMKSKYKETARGGLAVNIIEC