Protein Info for PGA1_c07800 in Phaeobacter inhibens DSM 17395

Annotation: putative transcriptional regulator, lacI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF00356: LacI" amino acids 9 to 54 (46 residues), 72.8 bits, see alignment 3.1e-24 PF00532: Peripla_BP_1" amino acids 67 to 329 (263 residues), 93.7 bits, see alignment E=2.9e-30 PF13407: Peripla_BP_4" amino acids 68 to 317 (250 residues), 57.2 bits, see alignment E=4e-19 PF13377: Peripla_BP_3" amino acids 177 to 334 (158 residues), 120 bits, see alignment E=2.4e-38

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 59% identity to sil:SPO0590)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJY4 at UniProt or InterPro

Protein Sequence (341 amino acids)

>PGA1_c07800 putative transcriptional regulator, lacI family (Phaeobacter inhibens DSM 17395)
MGKTPSAPTLNDVAKAAGVSTATVSRCLNSPDRVVETTRHRVMQAVESLGYTPNFAARVM
AAKRSFTIGAIIPTMDNAIFARGLQAFQDQLREDGYTLLVSSSAYSPEVEKEQIRALVAR
GADGLLLIGHEREEQIYQYLEKHRVPVLVAWSYAPERLQPSVGFSNKGAMRDLAHTVVDA
GHRHIAMISGILQGNDRAQNRVSGVRDAMRSRGLDPAALTLIEAPYEIEKGASAFAELMS
RAPRPTVVMCGNDVLAAGALREARSRGIAVPDDVSITGFDDIELAEIVSPALTTVHVPHR
EMGRKAAQELIAIVEGRSEGQSVCISTTLVTRQSLARPSGR