Protein Info for PGA1_c07780 in Phaeobacter inhibens DSM 17395

Annotation: TRAP transporter, subunit DctP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details amino acids 39 to 39 (1 residues), see Phobius details transmembrane" amino acids 36 to 38 (3 residues), see Phobius details PF03480: DctP" amino acids 81 to 341 (261 residues), 148.3 bits, see alignment E=1.5e-47

Best Hits

KEGG orthology group: None (inferred from 85% identity to sil:SPO0591)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DN13 at UniProt or InterPro

Protein Sequence (381 amino acids)

>PGA1_c07780 TRAP transporter, subunit DctP (Phaeobacter inhibens DSM 17395)
MTNSKDGLKSAERRNFLKLASTGSFTAALVAGAGGVLWSTEAVAQTAKEEKEREGAAEHI
MTVATAYVLGASRSYPIMQLDLKENIQNATNGKIYVKLAPGGQLGAGGALVQKVQGGTIQ
AAQHSLSNFAPFASTVDLINMPYLCGSNQRFTNLVTSDFWNAEVHPKVEANGFKALFYVN
IDPRVVAVRKGGNAVTSPGDMAGVKFRVPGSKMLQQYYRMVGANPTPVAWGETPSAIKQG
VADALDPSVGALYVFGFKDILSHVTFTQAVPDSQVYSCNLEWFNSLPADVQDGVMWGSEM
TAHQNLSKVPSARAYAMAELAKAGVAFHTLSDDQLGEWQEAGGYQRSEWDTFKTELAGSM
DNFAKLEEAAGTQGKYYVHDA