Protein Info for PGA1_c07750 in Phaeobacter inhibens DSM 17395

Annotation: histidinol dehydrogenase HisD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF00815: Histidinol_dh" amino acids 13 to 420 (408 residues), 452.1 bits, see alignment E=1e-139 TIGR00069: histidinol dehydrogenase" amino acids 24 to 419 (396 residues), 444.3 bits, see alignment E=2.3e-137

Best Hits

Swiss-Prot: 86% identical to HISX1_RUEPO: Histidinol dehydrogenase 1 (hisD1) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00013, histidinol dehydrogenase [EC: 1.1.1.23] (inferred from 86% identity to sil:SPO0594)

MetaCyc: 54% identical to sulfopropanediol 3-dehydrogenase monomer (Cupriavidus pinatubonensis JMP134)
RXN-11727 [EC: 1.1.1.308]

Predicted SEED Role

"putative histidinol dehydrogenase (but probably not)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.23

Use Curated BLAST to search for 1.1.1.23 or 1.1.1.308

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJX9 at UniProt or InterPro

Protein Sequence (435 amino acids)

>PGA1_c07750 histidinol dehydrogenase HisD (Phaeobacter inhibens DSM 17395)
MTREYLKKAALTPKSDASETHKTVQGILDDIEAGGDAKALEYAAKFDRYEGNVLLTDEEI
EAACALVPEKLKADIRFSHDNVRRFAELQKSTMQNVETEICPGFITGQKVIPVDAAGCYV
PGGRYSHIASAIMTVTTAKVAGCKHITACSPPRPGVGVAPAIVYAAHICGADKIMAMGGV
QGVAAMTFGLFGLPKANILVGPGNQFVAEAKRILFGRVGIDMIAGPTDSLILADRTADAH
IVATDLVSQAEHGYNSPVWLVTDDRALAEEVMRLVPGLIDDLPEVNRENAAAAWRDYAEV
ILCSDREEMAACSDDYAPEHLTVQAEDLDWWLGQLTCYGSLFLGEETTVSYGDKAAGTNH
VLPTSRAASYTGGLSVHKYMKIVTWQRATREGSKAVAEATARIARLEGMEGHARAADVRL
AKYFPDETFDLTANG