Protein Info for PGA1_c07740 in Phaeobacter inhibens DSM 17395

Annotation: putative gluconate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00106: adh_short" amino acids 14 to 202 (189 residues), 170 bits, see alignment E=8.9e-54 PF01370: Epimerase" amino acids 16 to 189 (174 residues), 23.5 bits, see alignment E=6.9e-09 PF08659: KR" amino acids 16 to 186 (171 residues), 45.4 bits, see alignment E=1.8e-15 PF13561: adh_short_C2" amino acids 19 to 251 (233 residues), 185.3 bits, see alignment E=2.9e-58

Best Hits

Swiss-Prot: 30% identical to FABG_VIBCH: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 72% identity to sil:SPO0595)

Predicted SEED Role

"Gluconate 5-dehydrogenase (EC 1.1.1.69)" (EC 1.1.1.69)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EUV1 at UniProt or InterPro

Protein Sequence (253 amino acids)

>PGA1_c07740 putative gluconate 5-dehydrogenase (Phaeobacter inhibens DSM 17395)
MADPRALFDLTGHTACITGASSGLGRRAAIALAAAGAQVVAVARRAEALESLCAEIRTSA
AHVTADVADRSTLDTLRDRVSAPFGPPDILIHAAGVNTRQPADQVTAEGWDQTIALNLSA
PFFLSQALVPAMKDRGWGRIVNFASLQTSRAFPGGMSYGASKGGIGQLTRAMAEAWSSFG
ITANAIGPGFFPTELTQAVFEDDARAARNAAQTCIGRNGLMEDLDGPLLFLCSEASAYVT
GQLLMVDGGFTAK