Protein Info for PGA1_c07730 in Phaeobacter inhibens DSM 17395

Annotation: putative zinc-binding alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 163 to 182 (20 residues), see Phobius details PF08240: ADH_N" amino acids 24 to 128 (105 residues), 87.2 bits, see alignment E=8e-29 PF00107: ADH_zinc_N" amino acids 170 to 283 (114 residues), 39.6 bits, see alignment E=5e-14

Best Hits

KEGG orthology group: K00008, L-iditol 2-dehydrogenase [EC: 1.1.1.14] (inferred from 64% identity to rde:RD1_3810)

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.14

Use Curated BLAST to search for 1.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DN07 at UniProt or InterPro

Protein Sequence (326 amino acids)

>PGA1_c07730 putative zinc-binding alcohol dehydrogenase (Phaeobacter inhibens DSM 17395)
MKALVYEGVETLVFRDVPMVAARPGEHLIRIHASGICGSDMHAYLGHDNRRPAPLILGHE
AAGTIEDGPQAGRRVTINPLVTCGSCAACAAGRENLCASRQIISMPPREGAFAQFVAMPE
RNLVTVPEDVPLSKAALAEPLAVSWHAARLALKALHPDMERRALVIGGGAIGLAAALALR
AMGVEDVAVQEPNAARRAFLADHCGQQAVAEFQGIVPLVLDAVGYAATRAAASAAAAPGG
VIAHVGLGEDAGGLDIRRMTLQEITFIGTYTYTAKDFRDTAQAIFDGRLGPLDWPEQRPL
SDGAAAFRDLRSSAVAAPKIILDPWA