Protein Info for Psest_0769 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 116 to 135 (20 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details PF00313: CSD" amino acids 4 to 58 (55 residues), 43 bits, see alignment E=3.3e-15 PF06961: DUF1294" amino acids 151 to 205 (55 residues), 88.8 bits, see alignment E=2.2e-29

Best Hits

KEGG orthology group: None (inferred from 83% identity to psa:PST_3575)

Predicted SEED Role

"Cold-shock DNA-binding domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHU9 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Psest_0769 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MEQRGTLKSWNDQKGFGFIRPEQGGEDVFAHISAVHGERRPLVGDRVLYVAGRDPQGRLR
AEHLRLDAPMTLDQPSIRQRPGSPRQSTEQQARPRASGRAAGKPARQLVAGNIQQLPLKL
VLFALLCLLPLAGSLYRLGTALPLAVYAVASLLTFFLYWRDKHSALKDRWRTPETTLHFF
ELAGGWPGALVAQQVFRHKTRKLSYQLAFWLIVVLHQAFWIDLLFIGSGFTRERLDWLLR
LL