Protein Info for Psest_0767 in Pseudomonas stutzeri RCH2

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 270 to 290 (21 residues), see Phobius details PF00497: SBP_bac_3" amino acids 42 to 256 (215 residues), 67.2 bits, see alignment E=1.2e-22 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 299 to 458 (160 residues), 153.2 bits, see alignment E=2.6e-49 PF00990: GGDEF" amino acids 304 to 456 (153 residues), 155.2 bits, see alignment E=1.3e-49

Best Hits

KEGG orthology group: None (inferred from 77% identity to psa:PST_3577)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIX8 at UniProt or InterPro

Protein Sequence (468 amino acids)

>Psest_0767 diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MARSLFIGLLVLYGGMAVAAADATLELSAAERAWLAERDSVSVCVDPDWLPFEMLNARGE
HEGIAADLLRLVAERAGLPLQIVPTRDWDASVAASKAGRCQLLSFLNQTPERDAWLIFTR
PLFTDANVLIARDEHPHVVNLSALTGASVALPSGTSVEEHIRHDFPQLRIIRSETDAQAL
MMVSEGKADLTIRSLTVAAYTIRHDGWLNLKIAGQVSGFDNQFRIGVLNSEPLLRDILDK
AIATVTPVELNQIANRHVPIRVETATDYRLVVQMVVVFSVVLLTSLFWIGRLRRLNEQLQ
IKSQTDSLTGLANRSALDGRFAVALEQARRYHRPLSIVMLDIDHFKRINDEFGHQMGDRV
LREIAGLLQSCLRGTDAVGRWGGEEFLVLCPETNGLQAEVFAERICEQVRAFPFSTGQRQ
SLSAGVAELIPADTTDSLLRRADAALYRAKRGGRDRVCLDVPAEQGEA