Protein Info for Psest_0763 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details PF09990: DUF2231" amino acids 21 to 140 (120 residues), 42.9 bits, see alignment E=2.6e-15

Best Hits

KEGG orthology group: None (inferred from 85% identity to psa:PST_3586)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b subunit family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH74 at UniProt or InterPro

Protein Sequence (149 amino acids)

>Psest_0763 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MTVITHRTQTTTHSISRHVPNPLHGTLLAGTVPLFLGAMLSDIAYFKTYEVQWSNFAAWL
IAGGLVFCGLALLFAVVNLIRAHHKKWRPLMYFLLLLATWLLGFINALEHAKDAWATMPL
GLVLSVIVTVLACAATWIGLSNLRDGGEA