Protein Info for HP15_727 in Marinobacter adhaerens HP15

Annotation: methyl-accepting chemotaxis sensory transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 210 to 232 (23 residues), see Phobius details PF08269: dCache_2" amino acids 43 to 196 (154 residues), 116.8 bits, see alignment E=2.3e-37 PF17200: sCache_2" amino acids 48 to 200 (153 residues), 125.1 bits, see alignment E=4.8e-40 PF00672: HAMP" amino acids 231 to 283 (53 residues), 60.8 bits, see alignment 2.6e-20 PF00015: MCPsignal" amino acids 374 to 530 (157 residues), 150.2 bits, see alignment E=1.1e-47

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 82% identity to maq:Maqu_2346)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQE8 at UniProt or InterPro

Protein Sequence (564 amino acids)

>HP15_727 methyl-accepting chemotaxis sensory transducer (Marinobacter adhaerens HP15)
MKNLTIQTRVLLLALVPVIVLTAFLTSYNLNQASAIGEEAVAGFSSDMEESKRQELQNYL
AVAKSSIEHLYNQPGSADDPEVREKAWEILRQLRFNDSGSTGYFFAYDTRGVNVMHGVNQ
SLEGKNLWDFQDPNGTFLIRELVKAARNGGGYVPYGWKNSETGQVAPKLGYAEMLPKWGV
MIGTGFWIDGLEAQVAAMESQVGTSLEDAVIGSVSTSLVALALIVLLALIVVRSIIRPLK
SAVSAMNDIASGDGDLTRRLDVSGKDELGQLATAFNSFADQVHGLVERVLSSTRTLNEAT
ADLNQVMTEAEQGVERQKSESDQVATAMNEMTAAAQEVASNASEASTAADHANGQVCDAQ
GLVHQATEVIGGLSEQVGEGVRVIEQLGTDSRRIDSVLEVIREIADQTNLLALNAAIEAA
RAGEAGRGFAVVADEVRTLARRTQQSTQEIQDMIERLQSGAGNAVKVIASISERSEATVE
ETRQVNDALQRIGQAVATITDMNTQIASAAEEQTSVSETINQNVHEIVAITEQTAQGTRR
AGNATQRLKNLASEMSEQVSRYRV