Protein Info for Psest_0759 in Pseudomonas stutzeri RCH2

Annotation: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF01135: PCMT" amino acids 22 to 136 (115 residues), 23.9 bits, see alignment E=8.4e-09 PF13847: Methyltransf_31" amino acids 36 to 147 (112 residues), 28.6 bits, see alignment E=2.8e-10 PF13649: Methyltransf_25" amino acids 40 to 134 (95 residues), 33.4 bits, see alignment E=1.5e-11 PF08241: Methyltransf_11" amino acids 41 to 138 (98 residues), 30.4 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 72% identical to YJHP_ECOLI: Uncharacterized protein YjhP (yjhP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to rfr:Rfer_2518)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.64

Use Curated BLAST to search for 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHU0 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Psest_0759 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT). (Pseudomonas stutzeri RCH2)
MDIPRIFNITESAHRIHNPITPEKLATLGAALRLQPGDRVLDLGSGSGEMLCTWARDHGI
VGTGIDMSQLFSEQATLRAVELGVADQVEFIHGDAAGHVSHEKVSVAACVGASWIAGGVA
GTLELLARSLRSGGIILIGEPYWRQLPPTEDVARGCLAEAISDFLVLPELLASFRQLGYD
VVEMVLADQDGWDRYEAAKWLTMRRWLEANPDDELAQEVRAQLSSEPERYATYTREYLGW
GVFALMPH