Protein Info for HP15_724 in Marinobacter adhaerens HP15

Annotation: periplasmic sensor signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 294 to 317 (24 residues), see Phobius details PF02743: dCache_1" amino acids 34 to 283 (250 residues), 46 bits, see alignment E=7.7e-16 PF00512: HisKA" amino acids 382 to 448 (67 residues), 28.3 bits, see alignment E=2.3e-10 PF02518: HATPase_c" amino acids 491 to 600 (110 residues), 70.5 bits, see alignment E=2.5e-23

Best Hits

Predicted SEED Role

"Signal transduction histidine kinase regulating C4-dicarboxylate transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQE5 at UniProt or InterPro

Protein Sequence (604 amino acids)

>HP15_724 periplasmic sensor signal transduction histidine kinase (Marinobacter adhaerens HP15)
MPYRIGVFLLFVATLVAAWLLGGWVGYRQVEQESLEESFRYRQLVANELNRYLPVPELMA
EHPLLQRALEAPDNPSAILSANEQMQRMATIVGSSDVYLMDTRGLTIAANNYLQPDSFVG
RNFNFRPYFYEAMESGDSAIYFALGLMSGVRGLYFSHPVRDEGGQIIGVVAVKVLVHELE
SQWDRPTGLREAEMVVLDHNGISFLASRQDWLYRNFSGMADAVPDEYSRRRYPDRDLTPM
ALKTLGTPWGLLEQSATVRIQDSGKPREYLSVSTPLPRMDWTLQVMVSTRSVVWTRLGFA
VGGAALFFGGLLTWLYLRERYRREAELALRGEQLERSVAERTADLENSNRKLVEEIRERE
RTQTELRETQQELIQAAKLAVLGQMSAGLNHEMNQPLTAIQTYARNSRRFLEKGAGEMVD
ANLSEIILLCDKMAELTRQFKVFARKSEGPPAVVDLRQPIDASLKIIVAQQSSSEIDIQW
HRPDSPVMCHGDLIRIEQVMVNLMANAVQAVEGGARPEIRIDIEETEQCWKCLVRDNGPG
LQGDTEQIFEPFFTTKSVKQGLGLGLSISRQIVDALGGSLTGRNRRDGPGAEFVVTLKKR
EAME