Protein Info for PGA1_c07540 in Phaeobacter inhibens DSM 17395

Annotation: transcription factor carD-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF02559: CarD_TRCF_RID" amino acids 9 to 65 (57 residues), 55.3 bits, see alignment E=5.7e-19 PF21095: CarD_C" amino acids 75 to 160 (86 residues), 86.1 bits, see alignment E=1.3e-28

Best Hits

KEGG orthology group: K07736, CarD family transcriptional regulator (inferred from 92% identity to sit:TM1040_0576)

Predicted SEED Role

"CarD-like transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJW1 at UniProt or InterPro

Protein Sequence (170 amino acids)

>PGA1_c07540 transcription factor carD-like protein (Phaeobacter inhibens DSM 17395)
MTKSKKPEFRPDDYVVYPAHGVGQIISIEEQEVAGFALELFVITFEKDKMTLRVPTNKAT
EIGMRSLSSPDVIAKAMTTLKGKAKVKRAMWSRRAQEYEQKINSGDLISIAEVVRDLHRT
DDQREQSYSERQLYEAALERLTREVAAVSGGDEISAAKQVDEVLTSRAAA