Protein Info for PGA1_c07460 in Phaeobacter inhibens DSM 17395

Annotation: glutathione S-transferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 10 to 73 (64 residues), 38.6 bits, E=3.4e-13
• PF13409: GST_N_2
  • amino acids 12 to 74 (63 residues), 34.7 bits, E=6.7e-12
• PF13417: GST_N_3
  • amino acids 13 to 78 (66 residues), 32.5 bits, E=2.7e-11
• PF00043: GST_C
  • amino acids 117 to 188 (72 residues), 25.4 bits, E=4.2e-09
• PF13410: GST_C_2
  • amino acids 120 to 180 (61 residues), 27 bits, E=1.2e-09
• PF14497: GST_C_3
  • amino acids 122 to 189 (68 residues), 22 bits, E=4.8e-08

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See I7DYE5 at UniProt or InterPro

Protein Sequence (204 amino acids)

>PGA1_c07460 glutathione S-transferase domain-containing protein (Phaeobacter inhibens DSM 17395)
MLTIHCLAYSRAIRLIWLMEDLGQPYTVVTYDRTASFRAPDSLAKVHPLGKSPVIEDGDT
MIAESATCLRYISDQYGDTQHRPSPGTAEAVHHDELLDYVESSFAEVAMGVLLPVLKSEE
AGDEAKRAMAQHLDYLTQNLPEQGLLFGDTATLADIQFSYILANLAAIGALEDAPRVARY
WTDLQKQPGYQAAVAKVGPMAPSF