Protein Info for Psest_0073 in Pseudomonas stutzeri RCH2

Annotation: ABC-type multidrug transport system, ATPase and permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details PF00664: ABC_membrane" amino acids 40 to 303 (264 residues), 71.5 bits, see alignment E=9.4e-24 PF00005: ABC_tran" amino acids 371 to 519 (149 residues), 114.9 bits, see alignment E=4.6e-37

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 93% identity to psa:PST_2888)

Predicted SEED Role

"Transport ATP-binding protein CydCD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GF90 at UniProt or InterPro

Protein Sequence (601 amino acids)

>Psest_0073 ABC-type multidrug transport system, ATPase and permease components (Pseudomonas stutzeri RCH2)
MNQATGLPQAQADELPLPSRPVAFLWHYICARPWHFGGLLALIIGAASCAVAVQYGMKLL
VDAMAQGTADRGAANVWWPLGLFIGLIVTENVFWRLGGWLGCRTVVASVVDIRVDLFKHL
TGHPMRYFTEHFAGSLGNRISAVGQAAGAIYGGLAWKIVPPIVDFLGAVVVLLTVDVRMA
VALILFVAIVAVLITGFGIRGRYKHQRFAAQSARVGGELVDAVSNVWTIKAFSARDREAE
RLAHEIGFEARAQRRSWMYLEKARVMHDICLSVMAGGMLIWAIQLWVGGEVTAGDVVLVS
ALTFRILHGSRDLALALVDATQQIGAIDDTLRIIVQPHGLDDSDNQLMLAEGDITFERIG
FSYPDRGAVFEGLDLHIPAGQKVGVVGSSGAGKSTLINLIQRLDDVQDGRILIDGQDIRS
VSQDSLREKIAVVPQETALFNRSIRENIRYGRPDASDEEVVAAARSAFCDGFIRELPQGY
DTLVGERGVMLSGGQRQRLGIARAFLKDAPILILDEATSALDTQSEGEIQAALNNLVHNR
TVVAVAHRLSTLASFDRIIVLRDGRIVEDGPPQELRRQGGEFDALWRMQAEGFAQEPGPA
V